PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna16216.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family NF-YB
Protein Properties Length: 354aa    MW: 40486.1 Da    PI: 6.9798
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna16216.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.31.5e-5558153297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrkting+d++wa++tlGfe+yv+plk+yl
  mrna16216.1-v1.0-hybrid  58 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGEDIIWAITTLGFEEYVHPLKLYL 143
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +kyrelegek
  mrna16216.1-v1.0-hybrid 144 QKYRELEGEK 153
                              *******996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.0E-5453182IPR009072Histone-fold
SuperFamilySSF471131.23E-3960163IPR009072Histone-fold
PfamPF008084.9E-2863127IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.2E-2091109No hitNo description
PROSITE patternPS00685094110IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.2E-20110128No hitNo description
PRINTSPR006154.2E-20129147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEDDNHGNNR LNGPNGGSPE NPCLNNSTPA SSCNSNINIH HNHNHNNNHN HHHHSSNKEQ  60
DRFLPIANVG RIMKKVIPGN GKISKDAKET VQECVSEFIS FVTGEASDKC QREKRKTING  120
EDIIWAITTL GFEEYVHPLK LYLQKYRELE GEKLNVPKQQ RLEQRLQQQQ QQQQVVQQEQ  180
EQQSIPNSYT VYSSTSLMSQ PTSFITHHHH HDPAFSLPFS PTSIQKQLQP QDQIDSVGHW  240
TELSSLNLWC LIFMVNVIKE FQLQRYKVEN NTTGDHVHER GNDDVGANLR WAYRAIGFPP  300
CMPLPLWLNQ WLNLDGFLLP DHGNTSSFGE KEVCVGKLYY NNMGQRPHKV CGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4456148294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4456148294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288122.11e-177PREDICTED: nuclear transcription factor Y subunit B-7
SwissprotQ9SIT96e-67NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLM5X2203e-93M5X220_PRUPE; Uncharacterized protein
STRINGGLYMA05G32680.11e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132492430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.13e-65nuclear factor Y, subunit B7